PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0027100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 327aa    MW: 35097.2 Da    PI: 9.2426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0027100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49.1e-201459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
   Spipo5G0027100 14 KGPWSPEEDEALQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding53.36.6e-1768110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++++Ede +v+a++++G++ W+tIar +  gRt++ +k++w++ 
   Spipo5G0027100  68 PFSADEDETIVRAHAKFGNK-WATIARLLH-GRTDNAVKNHWNST 110
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.276964IPR017930Myb domain
SuperFamilySSF466898.24E-3211107IPR009057Homeodomain-like
SMARTSM007178.1E-181362IPR001005SANT/Myb domain
PfamPF002492.0E-191459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-261567IPR009057Homeodomain-like
CDDcd001677.58E-171658No hitNo description
SMARTSM007175.6E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129419.70666115IPR017930Myb domain
CDDcd001675.23E-1168111No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2268114IPR009057Homeodomain-like
PfamPF002495.8E-1468110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAAAAGVSVE SRIKGPWSPE EDEALQRLVQ KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPQVEHRPFS ADEDETIVRA HAKFGNKWAT IARLLHGRTD NAVKNHWNST LKRKYAAVGG  120
GSGGAAGGGD LDEEEEGEEG EKSGERPVKR AASGMCFSAG SPSSSDVSDS SRHSAPATEA  180
ARSRIFRPIA RAGGVLPPAV EVTSSVAPTR GDDPATSLTL SLPGTSSSSS APEHHQDHER  240
RRLSPPALAA ETLPHLPPAA AEGRRREQPM SEELLATLQE MVRKEVRSYV MGLQQNGLVF  300
LEDPQKHLDA VRNAAVKRIG IRKLES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-381311457158MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-381311457158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3552413e-92AK355241.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1018A13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010928389.11e-109PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-81MYB44_ARATH; Transcription factor MYB44
TrEMBLK0A2241e-111K0A224_ELAGV; Sucrose responsive element-binding protein
STRINGVIT_07s0129g01050.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-67myb domain protein 73